- Recombinant Panicum mosaic virus Putative movement protein p6.6 (ORF2bis)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1120487
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 6,797 Da
- E Coli or Yeast
- 21551
- Putative movement protein p6.6 (ORF2bis)
Sequence
MATGKCYCPEDPRVGPLLVLCLLLLLILFSRSWNVAPVVVPSYHTVYHHEKYQNIEIQK